Protein coding transcript 28305

• Transcript: Ll_transcript_434127
• CDS coordinates: 974-1573 (+)
• Peptide sequence: MGALHQIDFASLRSAAITWHDVFADVPRPLLVVNIGGPTRNCRYGVDLAKQLVASLLSVLVSCGSVRISFSEKTPQKVTNIIVKELENNPKVYIWDGQEPNPRMGHLAWADAFVVTADSVSMISEACSTGKPVYVIGAERCRWKFTEFHKTLRDRGVVRPFTGSEDISESWSYPPLNDTADAAKRVHETLAARGWKLKT*
• ORF Type: complete

Annotations of Ll_transcript_434127

• Blastp: Mitochondrial fission protein ELM1 from Arabidopsis with 73.23% of identity
• Blastx: Mitochondrial fission protein ELM1 from Arabidopsis with 66.23% of identity
• Eggnog: Nucleoside-diphosphate-sugar epimerase(COG3660)
• Kegg: Link to kegg annotations (AT5G22350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447654.1)
• Pfam: Mitochondrial fission ELM1 (PF06258.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;