Protein coding transcript 2835

• Transcript: Ll_transcript_502695
• CDS coordinates: 113-997 (+)
• Peptide sequence: MTMDDECSIYVGGIPYDTTEDTIRTIFNLYGSILDVKIINDQRTAGKCYCFVTFTNPRSAIDAIDDMNGRSIGGRAVMVNGVKTRGGRSSFSREHQRRNMERNEDWDHGRGRDQDYYNDRVIYRDRHSDRSQERDRSQDHGRDRDRGFGHMHNHDHEKEPFVDKDRSRDEDCLDNKQGHNKAHGQGKEGEQNLDFGKWSKIDRTSDPDRSFGEDQNRHSRRSSGLYVTNQHSMDHLSDSNGSHDDQVDDQLKRSTQRLDQLKNEVSNHFITKMNEICQICYMIMSTIVGGFMVT*
• ORF Type: complete

Annotations of Ll_transcript_502695

• Blastp: Zinc finger CCCH domain-containing protein 25 from Oryza sativa with 37.35% of identity
• Blastx: Zinc finger CCCH domain-containing protein 25 from Oryza sativa with 38.27% of identity
• Eggnog: RNA binding motif protein X-linked 2(ENOG4111KW0)
• Kegg: Link to kegg annotations (4334639)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437495.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;