Protein coding transcript 2836

• Transcript: Ll_transcript_502643
• CDS coordinates: 95-910 (+)
• Peptide sequence: MAAVLSMLQHSTCPENLAFHFLSAHDAPELFSSIKSTFPYLNMKIYHFESNRVRGKISKSIRQALDQPLNYARIYLADSLPEDVQRVIYLDSDLVVVDDIAKLWGVNMEGKVVAAPEYCHANFTVYFTEMFWKDPIMSKTFKGRNPCYFNTGVMVMDVGKWRKEGYTKKVEEWMAVQKQQKRIYHLGSLPPFLLVLAGNIKGVDHRWNQHGLGGDNFEGKCRSLHPGPISLLHWSGKGKPWLRLDSRKPCTVDHLWAPYDLYRSSRHFFEE*
• ORF Type: complete

Annotations of Ll_transcript_502643

• Blastp: Probable galacturonosyltransferase-like 4 from Arabidopsis with 80.15% of identity
• Blastx: Probable galacturonosyltransferase-like 4 from Arabidopsis with 80% of identity
• Eggnog: polygalacturonate 4-alpha-galacturonosyltransferase transferase, transferring glycosyl groups transferase, transferring hexosyl groups(ENOG410YCH5)
• Kegg: Link to kegg annotations (AT3G06260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463046.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;