Protein coding transcript 284

• Transcript: Ll_transcript_336030
• CDS coordinates: 22-339 (+)
• Peptide sequence: MAEDEGHTANKVNEKVHFYKLFTFADSLDSTLMTIGVISAIANGLSQPLMTLIFGKLINAFGTTDQSNIVNEVSKVLLFFVYLAVWAGIASFLQVSCWMVTGERQA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_336030

• Blastp: ABC transporter B family member 9 from Arabidopsis with 59.43% of identity
• Blastx: ABC transporter B family member 9 from Arabidopsis with 59.43% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT4G18050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439667.1)
• Pfam: ABC transporter transmembrane region (PF00664.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;