Protein coding transcript 2840

• Transcript: Ll_transcript_502776
• CDS coordinates: 27-359 (+)
• Peptide sequence: MDPFKGQGGIQMLLTAEQEAQHIVSNARNLRTQRLKQAKDEAEKEASQYRTHMEEDYQKSLSESSGSSGSNVKRLDEETEAKINNLKQSASKVSTEVVDMLLKYVTNIKV*
• ORF Type: complete

Annotations of Ll_transcript_502776

• Blastp: V-type proton ATPase subunit G from Citrus with 57.8% of identity
• Blastx: V-type proton ATPase subunit G3 from Arabidopsis with 57.94% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461083.1)
• Pfam: Vacuolar (H+)-ATPase G subunit (PF03179.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;