Protein coding transcript 28438

• Transcript: Ll_transcript_314913
• CDS coordinates: 3-494 (+)
• Peptide sequence: GGPRKRSVTRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPIYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVIPNINPVLLPKRTGAGASSSAASTSKEPKSPSRAAKSPAKAAKSPSKAAKSPRKAAKSPRKAA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_314913

• Blastp: Histone H2A from Petroselinum with 85.61% of identity
• Blastx: Histone H2A from Petroselinum with 94.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003597346.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;