Protein coding transcript 28468

• Transcript: Ll_transcript_315976
• CDS coordinates: 394-924 (+)
• Peptide sequence: MQGQLVCSGCRSNLLYPRGAPNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYPCGATSVRCSCCHTVNLAPASNHVAHVHCGNCRTTLMYPYGAPSVKCAICHYITNVSMINGGFPIPVHSPNGMTNSATVPSTSTSMPQSQSHTVVVENPMSVDSNGKLVSNVVVGVTTDKK*
• ORF Type: complete

Annotations of Ll_transcript_315976

• Blastp: Protein LOL2 from Oryza sativa with 63.84% of identity
• Blastx: Protein LSD1 from Arabidopsis with 66.31% of identity
• Eggnog: LSD1 zinc finger domain containing protein, expressed(ENOG4111MH5)
• Kegg: Link to kegg annotations (4352767)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435213.1)
• Pfam: LSD1 zinc finger (PF06943.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;