| Transcript | Ll_transcript_315992 |
|---|---|
| CDS coordinates | 1890-2231 (+) |
| Peptide sequence | MSSYTLHRLCDYCSPSGLASVSCKYDVCTYFCTFNIAELIFYTFSWHLQMINGGFPIPVHSPNGMTNSATVPSTSTSMPQSQSHTVVVENPMSVDSNGKLVSNVVVGVTTDKK* |
| ORF Type | complete |
| Blastp | Protein LSD1 from Arabidopsis with 65.71% of identity |
|---|---|
| Blastx | Protein LOL1 from Arabidopsis with 75% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT4G20380) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435044.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer