Protein coding transcript 28488

• Transcript: Ll_transcript_316018
• CDS coordinates: 93-440 (+)
• Peptide sequence: MGCVGSSQSKVDGALKKIRKPKPWKHPQPITKTQLMQLRDEFWDTSPHYGGRKEIWDALRAAAEADDLSLAQAIVDSAGVIVQSSDLTVCYDERGAKYELPKYVLSEPTNLIGDN*
• ORF Type: complete

Annotations of Ll_transcript_316018

• Blastp: Ubiquitin domain-containing protein 1 from Silurana with 49.61% of identity
• Blastx: Ubiquitin domain-containing protein 1 from Danio with 48.44% of identity
• Eggnog: Ubiquitin domain containing(ENOG410XRPV)
• Kegg: Link to kegg annotations (448143)
• CantataDB: Link to cantataDB annotations (CNT0000677)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425711.1)
• Pfam: Ubiquitin-binding domain (PF16455.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;