| Transcript | Ll_transcript_315415 |
|---|---|
| CDS coordinates | 33-308 (+) |
| Peptide sequence | MEHTHTLVFEKMLNLPSRCNIGRCTHIFMILNFDDWLDQELLALGERIGHVSTGLSEDMLSKCLTESIYCSSDQTQDEATCVVCLEEYKNMD |
| ORF Type | 3prime_partial |
| Blastp | E3 ubiquitin-protein ligase MBR2 from Arabidopsis with 40.91% of identity |
|---|---|
| Blastx | E3 ubiquitin-protein ligase MBR2 from Arabidopsis with 40.91% of identity |
| Eggnog | zinc ion binding(ENOG41121N2) |
| Kegg | Link to kegg annotations (AT4G34040) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425433.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer