Protein coding transcript 28585

• Transcript: Ll_transcript_316378
• CDS coordinates: 188-982 (+)
• Peptide sequence: MSTAEAELITYWCHECDMSVALTRSQSPSPLLCPHCLTQSLELMDSPFHQNDAASPLSIFDSPFLHSLIFTTNPNDAVSGNDVVVEDPLSLLYPTTLTPSKPRASETVPVIAVTSSLLLNLDPNGVVLCAVCKDDIAVNDNAMTLPCNHLYHSDCITPWLLNHDSCPLCRFRVVEAEEKGEDGGGGGDGERAREIRRQLTVAMARLLELMEEEDEEDLYGLRTTLNHIASRNGILHEDSDGSVVNESVIVSVGGVGDGGEEQLP*
• ORF Type: complete

Annotations of Ll_transcript_316378

• Blastp: Probable E3 ubiquitin-protein ligase RHC1A from Arabidopsis with 45.21% of identity
• Blastx: Probable E3 ubiquitin-protein ligase RHC1A from Arabidopsis with 46.27% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT2G40830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456845.1)
• Pfam: zinc-ribbon (PF14369.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;