Transcript | Ll_transcript_316380 |
---|---|
CDS coordinates | 188-982 (+) |
Peptide sequence | MSTAEAELITYWCHECDMSVALTRSQSPSPLLCPHCLTQSLELMDSPFHQNDAASPLSIFDSPFLHSLIFTTNPNDAVSGNDVVVEDPLSLLYPTTLTPSKPRASETVPVIAVTSSLLLNLDPNGVVLCAVCKDDIAVNDNAMTLPCNHLYHSDCITPWLLNHDSCPLCRFRVVEAEEKGEDGGGGGDGERAREIRRQLTVAMARLLELMEEEDEEDLYGLRTTLNHIASRNGILHEDSDGSVVNESVIVSVGGVGDGGEEQLP* |
ORF Type | complete |
Blastp | Probable E3 ubiquitin-protein ligase RHC1A from Arabidopsis with 45.21% of identity |
---|---|
Blastx | Probable E3 ubiquitin-protein ligase RHC1A from Arabidopsis with 46.27% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT2G40830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456845.1) |
Pfam | zinc-ribbon (PF14369.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer