Protein coding transcript 2860

• Transcript: Ll_transcript_502656
• CDS coordinates: 156-662 (+)
• Peptide sequence: MGSNALFSSILSLFLLATLASASPFLSNNIFESGTYTGRALLQARKACGVDFENQNYTILTSQCKGPQYPPKVCCDAFKQFACPFADEISDETTDCASVMFSYINIYGKYPPGLFANECKEGKEGLDCSQVKTANNSDSSNTFHLAAPNSVLLMTTTAGFLGFLFHFF*
• ORF Type: complete

Annotations of Ll_transcript_502656

• Blastp: GPI-anchored protein LLG2 from Arabidopsis with 56.85% of identity
• Blastx: GPI-anchored protein LLG2 from Arabidopsis with 66.36% of identity
• Eggnog: (GPI)-anchored protein(ENOG410YIWK)
• Kegg: Link to kegg annotations (AT4G28280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450508.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;