Protein coding transcript 28611

• Transcript: Ll_transcript_314512
• CDS coordinates: 1053-2072 (+)
• Peptide sequence: MQLVKKYEGMVPDLELMFDCDDRPVVLASDYNDHDRNKITGPPPLFRYCGDRWTHDIVFPDWSFWGWAEINIRPWEYVLNDIKEGNKRIKWKDREPFAYWKGNPAVDETRKDLLKCNVSDAHDWNARLFVQDWEKESEQGYKNSNVANQCTYRHKIYIEGYAWSVSEKYILGCDSVTLLVTPRFHDFFIRSLQPLQHYWPIKDNDKCHSIQHAVEWGNNHTQKAQEIGRAASKFIQEDLNMDHVYDYMFHLLNEYAKLLKFEPTVPEGAVELCSEAMACTRNGTEKKFMSESFVGGPSIKAPCSLPHPFEPNTLRLFYANKLNVIKRIEKWEDEYWSQN*
• ORF Type: complete

Annotations of Ll_transcript_314512

• Blastp: Protein O-glucosyltransferase 1 from Homo with 25.99% of identity
• Blastx: Protein O-glucosyltransferase 1 from Homo with 25.44% of identity
• Eggnog: KDEL (Lys-Asp-Glu-Leu) containing(ENOG410XT5U)
• Kegg: Link to kegg annotations (56983)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015964462.1)
• Pfam: Glycosyl transferase family 90 (PF05686.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;