Protein coding transcript 28612

• Transcript: Ll_transcript_314513
• CDS coordinates: 2-907 (+)
• Peptide sequence: MIYVCTILFSFRNIFIRDNLSIYTNCDFRAEINIRPWEYVLNDIKEGNKRIKWKDREPFAYWKGNPAVDETRKDLLKCNVSDAHDWNARLFVQDWEKESEQGYKNSNVANQCTYRHKIYIEGYAWSVSEKYILGCDSVTLLVTPRFHDFFIRSLQPLQHYWPIKDNDKCHSIQHAVEWGNNHTQKAQEIGRAASKFIQEDLNMDHVYDYMFHLLNEYAKLLKFEPTVPEGAVELCSEAMACTRNGTEKKFMSESFVGGPSIKAPCSLPHPFEPNTLRLFYANKLNVIKRIEKWEDEYWSQN*
• ORF Type: complete

Annotations of Ll_transcript_314513

• Blastp: KDEL motif-containing protein 1 from Homo with 28.65% of identity
• Blastx: KDEL motif-containing protein 1 from Homo with 28.65% of identity
• Eggnog: KDEL (Lys-Asp-Glu-Leu) containing(ENOG410XT5U)
• Kegg: Link to kegg annotations (79070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006573770.1)
• Pfam: Glycosyl transferase family 90 (PF05686.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;