Protein coding transcript 287

• Transcript: Ll_transcript_336010
• CDS coordinates: 3-392 (+)
• Peptide sequence: FHIYNWPKSLIKYLDKSIRNFIWSGDTKTRKLVIVAWNKVCTPIKAGGLGLRSVYHMNQAALLKLTWELLTSKHEWAIFVRLRFGHAATPSQRYFKSSIWSCLKANWHTAISNSIWLVGDGTKINFLDR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_336010

• Blastp: Putative ribonuclease H protein At1g65750 from Arabidopsis with 31.5% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 31.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451747.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;