Protein coding transcript 28704

• Transcript: Ll_transcript_315767
• CDS coordinates: 61-528 (+)
• Peptide sequence: MSSEDRTAVMISWRKIPPLLNDVVHPSTTTLSFPNPTRFHFACVSLAQPKLVHDFSPSLSQLLKHPLAVLAFLPRDAALFAAGAIAGAAGKTATAPLDRIKLLMQTHGVRVGQDSTKKAISFIEVIFNLSYFNHPNLFLAEWLFFHFFQHVYSRV*
• ORF Type: complete

Annotations of Ll_transcript_315767

• Blastp: Probable envelope ADP,ATP carrier protein, chloroplastic from Arabidopsis with 49.28% of identity
• Blastx: Thylakoid ADP,ATP carrier protein, chloroplastic from Arabidopsis with 77.69% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (AT3G51870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450351.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;