Protein coding transcript 28777

• Transcript: Ll_transcript_316226
• CDS coordinates: 299-781 (+)
• Peptide sequence: MDSNKKNSCNSNGKALAESETSQLGSEQFASAFDVTAFSEHFNSSLMDFEVFSTLMNTPPMQPSSREFENVGVPVPVSSLPEPLDCLRGNLVPSFLSKTFDLVDDPGLDRIISWGANGASFVVWDPLEFSRFVLPRNFKHNNFSSFVRQLNTYVGITLIT*
• ORF Type: complete

Annotations of Ll_transcript_316226

• Blastp: Heat stress transcription factor A-3 from Arabidopsis with 33.48% of identity
• Blastx: Heat stress transcription factor A-3 from Arabidopsis with 40.8% of identity
• Eggnog: Transcription factor(COG5169)
• Kegg: Link to kegg annotations (AT5G03720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426589.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;