Transcript | Ll_transcript_316227 |
---|---|
CDS coordinates | 299-781 (+) |
Peptide sequence | MDSNKKNSCNSNGKALAESETSQLGSEQFASAFDVTAFSEHFNSSLMDFEVFSTLMNTPPMQPSSREFENVGVPVPVSSLPEPLDCLRGNLVPSFLSKTFDLVDDPGLDRIISWGANGASFVVWDPLEFSRFVLPRNFKHNNFSSFVRQLNTYVGITLIT* |
ORF Type | complete |
Blastp | Heat stress transcription factor A-3 from Arabidopsis with 33.48% of identity |
---|---|
Blastx | Heat stress transcription factor A-3 from Arabidopsis with 40.8% of identity |
Eggnog | Transcription factor(COG5169) |
Kegg | Link to kegg annotations (AT5G03720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426589.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer