Protein coding transcript 28988

• Transcript: Ll_transcript_315287
• CDS coordinates: 189-671 (+)
• Peptide sequence: MELSAPPRLAKCFPSQFLNFRVRIFQRTLNPTPQPLRASIFSVNHLNLTRMHNPRNVSSAALVGDIDTSAPTTLPLVNSVARIGEVKRVTKETNVAVKINLDGSGVADSSTGIPFLDHMLDVSAFNSIVVPSCWSYFKYLFASFSFYISCCYLFLLEFWL*
• ORF Type: complete

Annotations of Ll_transcript_315287

• Blastp: Imidazoleglycerol-phosphate dehydratase from Pisum with 58.73% of identity
• Blastx: Imidazoleglycerol-phosphate dehydratase from Pisum with 91.08% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002034)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461334.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;