Transcript | Ll_transcript_315295 |
---|---|
CDS coordinates | 189-887 (+) |
Peptide sequence | MELSAPPRLAKCFPSQFLNFRVRIFQRTLNPTPQPLRASIFSVNHLNLTRMHNPRNVSSAALVGDIDTSAPTTLPLVNSVARIGEVKRVTKETNVAVKINLDGSGVADSSTGIPFLDHMLDQIASHGVFDVHVKAKGDIHIDDHHTNEDVALAIGTALLQALGDRKGINRFGDFSAPLDEALVHVSLDLSGRPHLGYNLDIPTQRVGTYDTQVVLVYSYTLSLSLEFCPCSF* |
ORF Type | complete |
Blastp | Imidazoleglycerol-phosphate dehydratase from Pisum with 73.52% of identity |
---|---|
Blastx | Imidazoleglycerol-phosphate dehydratase from Triticum with 64.43% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461334.1) |
Pfam | Imidazoleglycerol-phosphate dehydratase (PF00475.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer