Protein coding transcript 28998

• Transcript: Ll_transcript_315276
• CDS coordinates: 713-1216 (+)
• Peptide sequence: MKNCFFVIFQQIASHGVFDVHVKATGDIHIDDHHTNEDVALAIGTALLQALGDRKGINRFGDFSASLDEALIHVSLDLSGRPYLGYNLDIPTQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGANSHHIIEATFKAFARALRQATEHDPRRLGTVPSSKGILSRS*
• ORF Type: complete

Annotations of Ll_transcript_315276

• Blastp: Imidazoleglycerol-phosphate dehydratase 1, chloroplastic from Arabidopsis with 88.75% of identity
• Blastx: Imidazoleglycerol-phosphate dehydratase 1, chloroplastic from Arabidopsis with 88.75% of identity
• Eggnog: imidazoleglycerolphosphate dehydratase(COG0131)
• Kegg: Link to kegg annotations (AT3G22425)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461334.1)
• Pfam: Imidazoleglycerol-phosphate dehydratase (PF00475.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;