Protein coding transcript 290

• Transcript: Ll_transcript_427269
• CDS coordinates: 70-366 (+)
• Peptide sequence: MGGSILARAFVQAYLQALQNAAKNGVAQETMQNAVLRGSKIMTEKEAQQILGVTKETPWEEIVKVSLSFVSHHNPFFVCKFAYNIHFVPCRNMTICLRK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_427269

• Blastp: Mitochondrial import inner membrane translocase subunit PAM16 like 2 from Arabidopsis with 60.94% of identity
• Blastx: Mitochondrial import inner membrane translocase subunit PAM16 like 2 from Arabidopsis with 62.16% of identity
• Eggnog: mitochondrial import inner membrane translocase, subunit(ENOG411286G)
• Kegg: Link to kegg annotations (AT3G59280)
• CantataDB: Link to cantataDB annotations (CNT0002650)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020234586.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;