Protein coding transcript 29023

• Transcript: Ll_transcript_314893
• CDS coordinates: 1336-1839 (+)
• Peptide sequence: MLLSYFARHGEIEEGSVAYDKDTNESRGFGFVTYKVAEAAKKAIDDPEKTLGGRNIIVKYADSNKGKTGQQSFPAGVVPMAPLPMVPGYVQPGKAQGGAAAPVGYTYPQAVAPYPASSYPGPPVAPSPYPTQGQVPYRSVSSQKDRLGFPPAQPVGMNNYPYYYPKQ*
• ORF Type: complete

Annotations of Ll_transcript_314893

• Blastp: UBP1-associated protein 2C from Arabidopsis with 43.94% of identity
• Blastx: UBP1-associated protein 2C from Arabidopsis with 37.07% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G15010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440828.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;