Transcript | Ll_transcript_314895 |
---|---|
CDS coordinates | 215-637 (+) |
Peptide sequence | MEDLKKRKLEEHGNGGFASKEDLRFLLEPLSKPQLVDLLTKLGSQYPSIEEEIKSIASADPVHRKLFVRGLAWNTTSETLRAAFQEHGEIEEGAVIYDKTTSKSRGYGFITYRNMESTQLALKASNKLIDVSLSCFVALA* |
ORF Type | complete |
Blastp | UBP1-associated protein 2A from Arabidopsis with 40.16% of identity |
---|---|
Blastx | UBP1-associated protein 2A from Arabidopsis with 42.02% of identity |
Eggnog | Rna-binding protein(COG0724) |
Kegg | Link to kegg annotations (AT3G56860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440828.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer