Protein coding transcript 291

• Transcript: Ll_transcript_427274
• CDS coordinates: 195-908 (+)
• Peptide sequence: MAAAVRFHFYIFILSTPLFFSPLLSIDPENEALLKLKKSLVTSGSLSSWVPNQNPCSSKWDGVICNKNAITNLHLTDKGLSGKIDIQALMQIPSLRSISLINNNFSGPMPEFNKLGALKAIYLTKNQFSGPIPSDFFSGLGSLKKIWISNNKFSGNIPDSLRKLKFLNELHLENNEFSGPVPEFDNDIKSLDMSNNKLQGVIPASMVKFGANSFSGNDELCGKPLDKDCEAGSKSGMS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_427274

• Blastp: Pollen receptor-like kinase 1 from Arabidopsis with 45.83% of identity
• Blastx: Pollen receptor-like kinase 1 from Arabidopsis with 46.34% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G35390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462574.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;