Protein coding transcript 29118

• Transcript: Ll_transcript_314612
• CDS coordinates: 1-408 (+)
• Peptide sequence: TEKNREKERGEEEEGELETSSLDGREYEIQDLRERLKSSGVSRFNLIENELSWRRKFSRETLLAGFKDFVILPHLWWYRAWSAFILLWAVYSSFFTPMEFGFFRGLPENLFVLDFIGQIFFLVDIVLQFFVAYRDS
• ORF Type: internal

Annotations of Ll_transcript_314612

• Blastp: Potassium channel SKOR from Arabidopsis with 51.61% of identity
• Blastx: Potassium channel SKOR from Arabidopsis with 53.39% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT3G02850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457113.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;