Protein coding transcript 29187

• Transcript: Ll_transcript_316480
• CDS coordinates: 453-767 (+)
• Peptide sequence: MCRKQDRATLMHYAVQTASSQTIKILLLYNVDINRPDKDGWTPLHLAVQTQRTDLVRLLLIKGADKTLRNKDGLTPLDLCLYLGQGLRTYELIKLLREKRQYKF*
• ORF Type: complete

Annotations of Ll_transcript_316480

• Blastp: Ankyrin repeat domain-containing protein, chloroplastic from Arabidopsis with 73.63% of identity
• Blastx: Ankyrin repeat domain-containing protein, chloroplastic from Arabidopsis with 73.63% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT5G66055)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422582.1)
• Pfam: Ankyrin repeats (many copies) (PF13637.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;