Protein coding transcript 2923

• Transcript: Ll_transcript_336430
• CDS coordinates: 110-757 (+)
• Peptide sequence: MASSASEEEVTLTVKWSGKEYTVRVCGDDTVGELKRRICELTNVLPIRQKLLYPKAGSKLNDDSLFLSQLPLKSSFKMTMIGTTEEDLIVDPVESPEIVDDFELGKEETVDIKDMEVNKQKLIRRISQFKIEVQNPCRKGKKLLVLDIDYTLFDHRSTAENPLQLMRPCNHHLYHCAYFLLASLLSVIFCLFRSLYFLVQTFTSFLHQFIQSMTL*
• ORF Type: complete

Annotations of Ll_transcript_336430

• Blastp: Ubiquitin-like domain-containing CTD phosphatase from Arabidopsis with 74.43% of identity
• Blastx: Ubiquitin-like domain-containing CTD phosphatase from Arabidopsis with 74.01% of identity
• Eggnog: CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A)(COG5190)
• Kegg: Link to kegg annotations (AT4G06599)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464724.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;