| Transcript | Ll_transcript_314599 |
|---|---|
| CDS coordinates | 206-601 (+) |
| Peptide sequence | MSWQTYVDEHLLCDIEGNQLTSAAIIGQDGSVWAQSTNFPQFKPEEIAAIVNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNLALIIGIYDEPMTPGQCNVVVERLGDYLVDQGL* |
| ORF Type | complete |
| Blastp | Profilin-1 from Ricinus with 89.31% of identity |
|---|---|
| Blastx | Profilin-1 from Ricinus with 89.31% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (8265128) |
| CantataDB | Link to cantataDB annotations (CNT0002491) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431556.1) |
| Pfam | Profilin (PF00235.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer