Transcript | Ll_transcript_316664 |
---|---|
CDS coordinates | 234-1283 (+) |
Peptide sequence | MVTGSRMEVVSGTQIFSAKVRKTIQSIKEIVGNHSDADIYVALKETNMDPNETTQKLLFQDPFHEVKRRRERKKEPQNQNVGTKSSAERSEPRRHSESVGQGMKFHAPYERNFRRANYSRNTLPDPFHEVKRRRERKKEPQNQNVGTKSSAERSEPRRHSESVGQGMKFHAPYERNFRRANYSRNTLPGNGREFRVVRDNRVNHIYKEVKPPSLQCSTSANEQSNANTSDKGPTTAATYQRSSGVKNSSQALNGPSDSHARSSKDVVSNASDRKFASDGKQSVLLNAAARVQSIKPDSTHQNSTTVASTSSTVGVYSSSTDPVHVPSPDSRASSVVGAIRREVGVFLFN* |
ORF Type | complete |
Blastp | GBF-interacting protein 1 from Arabidopsis with 50.68% of identity |
---|---|
Blastx | GBF-interacting protein 1 from Arabidopsis with 46.77% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT3G13222) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461286.1) |
Pfam | Protein of unknown function (DUF1296) (PF06972.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer