Protein coding transcript 29413

• Transcript: Ll_transcript_316674
• CDS coordinates: 190-855 (+)
• Peptide sequence: MATVIDGKAVAQSIRSEIAAEVRVLSEKYGKVPGLAVIIVGSKKDSQSYVGMKRKACAELGIKSFDHDLPEQVSEADLIKEVHQLNLNPDVHGILVQLPLPKHINEEKVLTEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKACLELLSRSGVSIKGKKAVVVGRSNIVGLPASLLLLKADATVTIVHSHTSQPESIIREADIVIAAAGQPMMVTRKT*
• ORF Type: complete

Annotations of Ll_transcript_316674

• Blastp: Bifunctional protein FolD 2 from Arabidopsis with 80.56% of identity
• Blastx: Bifunctional protein FolD 2 from Arabidopsis with 79.91% of identity
• Eggnog: Catalyzes the oxidation of 5,10- methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10- formyltetrahydrofolate (By similarity)(COG0190)
• Kegg: Link to kegg annotations (AT3G12290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440855.1)
• Pfam: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;