Transcript | Ll_transcript_316679 |
---|---|
CDS coordinates | 190-855 (+) |
Peptide sequence | MATVIDGKAVAQSIRSEIAAEVRVLSEKYGKVPGLAVIIVGSKKDSQSYVGMKRKACAELGIKSFDHDLPEQVSEADLIKEVHQLNLNPDVHGILVQLPLPKHINEEKVLTEISLEKDVDGFHPLNIGKLAMKGRDPLFLPCTPKACLELLSRSGVSIKGKKAVVVGRSNIVGLPASLLLLKADATVTIVHSHTSQPESIIREADIVIAAAGQPMMVTRKT* |
ORF Type | complete |
Blastp | Bifunctional protein FolD 2 from Arabidopsis with 80.56% of identity |
---|---|
Blastx | Bifunctional protein FolD 2 from Arabidopsis with 79.91% of identity |
Eggnog | Catalyzes the oxidation of 5,10- methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10- formyltetrahydrofolate (By similarity)(COG0190) |
Kegg | Link to kegg annotations (AT3G12290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440855.1) |
Pfam | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer