Protein coding transcript 29439

• Transcript: Ll_transcript_314796
• CDS coordinates: 878-1480 (+)
• Peptide sequence: MAYWTVKVLRYPTDIFFQRRYGCRAMMLETVAAVPGMVGGMLLHFKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPKWYERALVISVQGVFFNAYFLGYLLSPKFAHRMVGYLEEEAIHSYTEFLKELDKGTIENVPAPAIAIDYWQLPPNSTLRDVVMVVRADEAHHRDVNHFASDIHYQGRELREAAAPIGYH*
• ORF Type: complete

Annotations of Ll_transcript_314796

• Blastp: Ubiquinol oxidase 1, mitochondrial from Soja with 95% of identity
• Blastx: Ubiquinol oxidase 1, mitochondrial from Soja with 91.74% of identity
• Eggnog: alternative oxidase(ENOG410YFEH)
• Kegg: Link to kegg annotations (547924)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421475.1)
• Pfam: Alternative oxidase (PF01786.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;