Transcript | Ll_transcript_519605 |
---|---|
CDS coordinates | 2-316 (+) |
Peptide sequence | AGSTRRKLVIISVLIEHPTEGLILFETGGGKDYPEVWGAPLNDIFARVDYSEDHELDAQIKKTGHDIKDVKAVIMGHLHLDHAGGLEHFKGTDVPIYVHEQEIKH |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | N-acyl homoserine lactonase from Arthrobacter with 35.42% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAP57766) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001239686.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer