Protein coding transcript 29507

• Transcript: Ll_transcript_315095
• CDS coordinates: 150-737 (+)
• Peptide sequence: MMQWPGAYCNTKQSCCYPKTGKPKADFGIHGLWPNYNDGSWPLNCDPDSGFDKSQIRELMSSMNEKWPSLSCPSSNGSRFWSHEWEKHGTCAESELDQREYFETALNLKEKINLLQILKDADIEPDDGFYSLNSISEAIKKGTGFTPGIECNKDSAHNSQLYQVYMCVDTSGTNLIECPILPRTKCVSDIQFPKF*
• ORF Type: complete

Annotations of Ll_transcript_315095

• Blastp: Ribonuclease 3 from Arabidopsis with 63.08% of identity
• Blastx: Ribonuclease 3 from Arabidopsis with 63.73% of identity
• Eggnog: ribonuclease T2 activity(ENOG4111M7G)
• Kegg: Link to kegg annotations (AT1G26820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457112.1)
• Pfam: Ribonuclease T2 family (PF00445.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;