Protein coding transcript 29514

• Transcript: Ll_transcript_315076
• CDS coordinates: 317-844 (+)
• Peptide sequence: MKSKGSILMKLVILQYLAVLCFSQDFDFFYFVQQWPGSYCDTQRSCCYPTTGKPSADFGIHGLWPNYKDGSYPSNCDPNNPFQPSQISDLISSLRRNWPTLACPSGNGIQFWTHEWEKHGTCSESILRSQHDYFESALNLKQRANLLQALTSAGTLHVTLCILILYLCKCHHTVT*
• ORF Type: complete

Annotations of Ll_transcript_315076

• Blastp: Extracellular ribonuclease LE from Lycopersicon with 70.07% of identity
• Blastx: Extracellular ribonuclease LE from Lycopersicon with 70.55% of identity
• Eggnog: ribonuclease T2 activity(ENOG4111M7G)
• Kegg: Link to kegg annotations (544098)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434081.1)
• Pfam: Ribonuclease T2 family (PF00445.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;