Protein coding transcript 29524

• Transcript: Ll_transcript_315084
• CDS coordinates: 335-772 (+)
• Peptide sequence: MKFGKRLKKQIEESLPEWRDNYLCYKKMKKLVKLISASPMFMNGSLECDKVEAEFVYLLNNEIDKFNGFFMEKEEDFIIRHEELQQRIKRVVELWGPNSNNPSEVDYKEEMGKIRRAIVDFHGEMVLLVHYSNINYTGISFLPFT*
• ORF Type: complete

Annotations of Ll_transcript_315084

• Blastp: SPX domain-containing protein 3 from Arabidopsis with 56.43% of identity
• Blastx: SPX domain-containing protein 3 from Arabidopsis with 56.43% of identity
• Eggnog: SPX domain gene(ENOG410XU76)
• Kegg: Link to kegg annotations (AT2G45130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462834.1)
• Pfam: SPX domain (PF03105.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;