| Transcript | Ll_transcript_314757 |
|---|---|
| CDS coordinates | 3-485 (+) |
| Peptide sequence | IKQTTMYSSSSSSQSGLTRYASAPTSLLTTAVDAVITAGSHPLPPQYFSGESPEPNFHPLGGGASSTNLIRQKSSPAGFLNHLATTLHHSDKGFTITRGASTYSSHGHGISNSGHAHTVSRLKTQLSLTGQDSLSHISEVNENIEEGTTSDNGHHRPVPS* |
| ORF Type | 5prime_partial |
| Blastp | Transcription factor bHLH128 from Arabidopsis with 50.67% of identity |
|---|---|
| Blastx | - |
| Eggnog | Transcription factor(ENOG410YAU7) |
| Kegg | Link to kegg annotations (AT1G05805) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452511.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer