Protein coding transcript 29543

• Transcript: Ll_transcript_314769
• CDS coordinates: 1497-1862 (+)
• Peptide sequence: MDGDILNCLNDLESQFSLPQTTLEMATVENLLHIPEDSVPCKIRAKRGCATHPRSIAERERRTRISGKLKKLQDLVPNMDKQTSYSDMLDLAVQHIKGLQSQVQKLHSELENCTCGCKESM*
• ORF Type: complete

Annotations of Ll_transcript_314769

• Blastp: Transcription factor bHLH128 from Arabidopsis with 79.63% of identity
• Blastx: Transcription factor bHLH128 from Arabidopsis with 62.37% of identity
• Eggnog: Transcription factor(ENOG410YAU7)
• Kegg: Link to kegg annotations (AT1G05805)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451772.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;