| Transcript | Ll_transcript_314777 |
|---|---|
| CDS coordinates | 1497-1820 (+) |
| Peptide sequence | MDGDILNCLNDLESQFSLPQTTLEMATVENLLHIPEDSVPCKIRAKRGCATHPRSIAERVSNFCFEREPLTFCQQNGLPCFRVSVCMMELLNIMDAFFFVFFLRIKS* |
| ORF Type | complete |
| Blastp | Transcription factor bHLH129 from Arabidopsis with 81.25% of identity |
|---|---|
| Blastx | Transcription factor bHLH128 from Arabidopsis with 51.49% of identity |
| Eggnog | transcription factor(ENOG41108V5) |
| Kegg | Link to kegg annotations (AT2G43140) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451772.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer