Protein coding transcript 2956

• Transcript: Ll_transcript_444775
• CDS coordinates: 92-1042 (+)
• Peptide sequence: MSSKSFRDEIDLSLGEPMGLKEEPEMDAAIRVTPTAISMQVNKALAQAQPTQKRSSTKDRHTKVEGRGRRIRMPATCAARIFQLTRELGHKSDGETIRWLLEHAEPAIIAATGTGTVPAIAMSVNGTLKIPTTSPSSAKANSDPEPGDPQEKKKRKRPANSAYVDINDGVVSVSAGLTTSSNANKSIPLQNAIPLPQGMVPVWAIPSNAVVPAAGAFFVVPSPMAAGPSNPPQFFTLARPISAFVSPMVPTPVQLQHHPTSTNACSASPSSKSPPIATVMAPTTTATATTQMLRDFSLEIYDKQELQFMSRSSSRQ*
• ORF Type: complete

Annotations of Ll_transcript_444775

• Blastp: Transcription factor TCP9 from Arabidopsis with 55.44% of identity
• Blastx: Transcription factor TCP9 from Arabidopsis with 66.84% of identity
• Eggnog: transcription factor(ENOG410YJS2)
• Kegg: Link to kegg annotations (AT2G45680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460893.1)
• Pfam: TCP family transcription factor (PF03634.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;