Protein coding transcript 29655

• Transcript: Ll_transcript_315931
• CDS coordinates: 96-809 (+)
• Peptide sequence: MPFLSPYLQSIGSNFRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKQFKTKVEEIHQQGTSACYCTSEAKTPSPNIFGKSLYTFYIGQNDFTSNLASVGIGGVKQYLPQVVSQITGTIKELYNLGGLTFMVLNLAPIGCYPSFLVQLPHDGSDLDEFGCMVSYNNAVVEYNNMLKDALKQTRETLPKASIIYVDTYTVLLELFHHPTSHGLITSPCSCFIITKTKICVRR*
• ORF Type: complete

Annotations of Ll_transcript_315931

• Blastp: GDSL esterase/lipase At4g01130 from Arabidopsis with 62.67% of identity
• Blastx: GDSL esterase/lipase At4g01130 from Arabidopsis with 61.8% of identity
• Eggnog: GDSL esterase lipase(ENOG410Y9BR)
• Kegg: Link to kegg annotations (AT4G01130)
• CantataDB: Link to cantataDB annotations (CNT0000130)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423902.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;