Transcript | Ll_transcript_315934 |
---|---|
CDS coordinates | 164-661 (+) |
Peptide sequence | MSSRASINSLIIFTVLLSCLLGLSHAKCDFKAIFNFGDSNSDTGGFFAAFPAESGPFGMTYFNKPAGRASDGRLIVDFLAQAFGMPFLSPYLQSIGSNFRHGANYATLASTVLLPNTSLFVTGISPFSLAIQLNQMKQFKTKVEEIHQQGTKISNLIYIYSALIF* |
ORF Type | complete |
Blastp | GDSL esterase/lipase At4g01130 from Arabidopsis with 73.72% of identity |
---|---|
Blastx | GDSL esterase/lipase At4g01130 from Arabidopsis with 73.72% of identity |
Eggnog | GDSL esterase lipase(ENOG410Y9BR) |
Kegg | Link to kegg annotations (AT4G01130) |
CantataDB | Link to cantataDB annotations (CNT0000130) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423902.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer