Protein coding transcript 29674

• Transcript: Ll_transcript_315948
• CDS coordinates: 696-1670 (+)
• Peptide sequence: MYFRRSVWNLQCLMRLLSDCYRPINVPCRWDSSTMMLEEQPIKQEKQLFQCNSQSFEVQYQENEYKENLKSSHLGFSRRVSSPETVSLESKSCQSIKMLTDDWELSSPFSAVYDLCREPDVKSSVHDHVLPELVIDEDDDDEIMSSYVIEVNSNLREESCKTSAVDEAIAWAKEKFQSRNSDDESRLRKDSSEQNVRVEGRHETDEYHDDGIRIVKSPKKLETETEKLDRDIRLWSSGKENDIRLLLSSLHQIVWPESGWYAVPIMSLIQSSQVKKAYQKARLCLHPDKLQQRGATVLQKYIAQKAFSILQDAWTSFISEDVSF*
• ORF Type: complete

Annotations of Ll_transcript_315948

• Blastp: Auxilin-related protein 2 from Arabidopsis with 52.63% of identity
• Blastx: Auxilin-related protein 2 from Arabidopsis with 52.63% of identity
• Eggnog: UBA TS-N domain protein(ENOG410YGT5)
• Kegg: Link to kegg annotations (AT4G12770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437529.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;