Protein coding transcript 297

• Transcript: Ll_transcript_519599
• CDS coordinates: 2-526 (+)
• Peptide sequence: HEFNSRSLRKFVEVVVEAEFNQRLIPTLNDSQSQSKTLDFQDILQRFAFDNICKIAFGFDPEYLTPSLKDSNLTKAFEDAHIISTKRFREPLALVWKMKRKLNIGSEKRLRIAVSEVQEFARKIVREKKKELKEKASLDSVDMLSRFLTSGHSDEDFLMDIVISFILAGKYTTSA
• ORF Type: internal

Annotations of Ll_transcript_519599

• Blastp: Cytochrome P450 94A1 from Vicia with 66.29% of identity
• Blastx: Cytochrome P450 94A1 from Vicia with 66.29% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAD10204)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444465.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;