Transcript | Ll_transcript_314489 |
---|---|
CDS coordinates | 1-645 (+) |
Peptide sequence | LNQTVFYIPEPHKNIQYPILNLIYKNHYCLSPLIFNNTTQKQRSPSTNMATVTSAAVTIPSFTALKANTATKAIPTKAKVSSSPRLFSAKASLKDFGVAIVATAATAILSSNALAVEVLLGSDDGGLAFVPNDFSVGAGEKIVFKNNAGYPHNVVFDEDEVPSGVDVSKISMSEEDLLNGPGETYSVTLSEKGSYSFYCSPHQGAGMKGKVTVN* |
ORF Type | 5prime_partial |
Blastp | Plastocyanin, chloroplastic from Pisum with 72.51% of identity |
---|---|
Blastx | Plastocyanin, chloroplastic from Pisum with 72.51% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449495.1) |
Pfam | Copper binding proteins, plastocyanin/azurin family (PF00127.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer