Transcript | Ll_transcript_444759 |
---|---|
CDS coordinates | 108-965 (+) |
Peptide sequence | MVTGSINDVVSSIDMEKMLCELLVDTKQPICERFRALFSLRNLKGPAPRDALIRATRDSSNLLAHEAAFALGQMQEIEAIPALASILNDLSLHPIVRHEAAEALGAIGSDSNLPLLENSLDLDPAEEVRETCELALQRIRHFKHAAISHQLSAPDASPFKSVDPAAPATSSLSVHQLRKLLLDEEKGMYARYAALFALRNDGGKEAVAAIIDSLGSKSALLRHEVAYVLGQLQDKVASAALSNILKDVTEHPMVRHEAAEALGSIAGITIYNQIPLKVLFFFKLI* |
ORF Type | complete |
Blastp | Deoxyhypusine hydroxylase from Arabidopsis with 72.14% of identity |
---|---|
Blastx | Deoxyhypusine hydroxylase from Arabidopsis with 72.14% of identity |
Eggnog | Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)- L-lysine intermediate to form hypusine, an essential post- translational modification only found in mature eIF-5A factor (By similarity)(COG1413) |
Kegg | Link to kegg annotations (AT3G58180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426176.1) |
Pfam | HEAT repeats (PF13646.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer