Protein coding transcript 29821

• Transcript: Ll_transcript_316332
• CDS coordinates: 745-1458 (+)
• Peptide sequence: MNTLKGRIHWRNTLQQLERVGPKSVGVCLLTSAFVGMAFTIQFVREFTRLGLNRSVGGVLAMAFSRELSPVVTAIVVCGRIGSAFAAELGTMQVSEQTDTLRVLGSDPVDYLVTPRVIATSIALPLLTLLCFTLSMASSAILADSIYGVSINIILDSARRALRPWDIISAMIKSQVFGAIISIVSCAWGVTTLGGAKGVGESTTSAVVISLVGIFIADFALSCCFFQGAGDQLKNCV*
• ORF Type: complete

Annotations of Ll_transcript_316332

• Blastp: Protein TRIGALACTOSYLDIACYLGLYCEROL 1, chloroplastic from Arabidopsis with 83.12% of identity
• Blastx: Protein TRIGALACTOSYLDIACYLGLYCEROL 1, chloroplastic from Arabidopsis with 72.29% of identity
• Eggnog: ABC transporter (permease)(COG0767)
• Kegg: Link to kegg annotations (AT1G19800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445752.1)
• Pfam: Permease MlaE (PF02405.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;