Protein coding transcript 29826

• Transcript: Ll_transcript_316320
• CDS coordinates: 700-1527 (+)
• Peptide sequence: MNTHDAPNDLPPKFLSNWSPPRYLWRGLSVLILAGQVIMNTLKGRIHWRNTLQQLERVGPKSVGVCLLTSAFVGMAFTIQFVREFTRLGLNRSVGGVLALAFSRELSPVVTAIVVCGRIGSAFAAELGTMQVSEQTDTLRVLGSDPVDYLVTPRVIATSIALPLLTLLCFTLGMASSAILADSVYGVSINIILDSARRALRPWDIISAMIKSQVFGAIISIVSCAWGVTTLGGAKGVGESTTSAVVISLVGIFVADFALSCCFFQGAGDQLKNCV*
• ORF Type: complete

Annotations of Ll_transcript_316320

• Blastp: Protein TRIGALACTOSYLDIACYLGLYCEROL 1, chloroplastic from Arabidopsis with 79.78% of identity
• Blastx: Protein TRIGALACTOSYLDIACYLGLYCEROL 1, chloroplastic from Arabidopsis with 76.08% of identity
• Eggnog: ABC transporter (permease)(COG0767)
• Kegg: Link to kegg annotations (AT1G19800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448274.1)
• Pfam: Permease MlaE (PF02405.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;